Bio::Tools
Sigcleave
Summary
Bio::Tools::Sigcleave - Bioperl object for sigcleave analysis
Package variables
Privates (from "my" definitions)
$expected(2) = $WeightTable_pro{$i}[15]
$expected(1) = $WeightTable_euc{$i}[15]
Included modules
Inherit
Synopsis
use Bio::Tools::Sigcleave ();
# to keep the module backwar compatible, you can pass it a sequence string, but
# there recommended say is to pass it a Seq object
# this works
$seq = "MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGI";
$sig = new Bio::Tools::Sigcleave(-seq => $seq,
-type => 'protein',
-threshold=>'3.5',
);
# but you do:
$seqobj = Bio::PrimarySeq->new(-seq => $seq);
$sig = new Bio::Tools::Sigcleave(-seq => $seqobj,
-threshold=>'3.5',
);
# now you can detect procaryotic signal sequences as well as eucaryotic
$sig->matrix('eucaryotic'); # or 'procaryotic'
# you can use this method to fine tune the threshod before printing out the results
$sig->result_count:
%raw_results = $sig->signals;
$formatted_output = $sig->pretty_print;
Description
"Sigcleave" was a program distributed as part of the free EGCG add-on
to earlier versions of the GCG Sequence Analysis package. A new
implementation of the algorithm is now part of EMBOSS package.
From the EGCG documentation:
SigCleave uses the von Heijne method to locate signal sequences, and
to identify the cleavage site. The method is 95% accurate in
resolving signal sequences from non-signal sequences with a cutoff
score of 3.5, and 75-80% accurate in identifying the cleavage
site. The program reports all hits above a minimum value.
The EGCG Sigcleave program was written by Peter Rice (E-mail:
pmr@sanger.ac.uk Post: Informatics Division, The Sanger Centre,
Wellcome Trust Genome Campus, Hinxton, Cambs, CB10 1SA, UK).
Since EGCG is no longer distributed for the latest versions of GCG,
this code was developed to emulate the output of the original program
as much as possible for those who lost access to sigcleave when
upgrading to newer versions of GCG.
There are 2 accessor methods for this object. "signals" will return a
perl associative array containing the sigcleave scores keyed by amino
acid position. "pretty_print" returns a formatted string similar to
the output of the original sigcleave utility.
In both cases, the "threshold" setting controls the score reporting
level. If no value for threshold is passed in by the user, the code
defaults to a reporting value of 3.5.
In this implemntation the accessor will never return any
score/position pair which does not meet the threshold limit. This is
the slightly different from the behaviour of the 8.1 EGCG sigcleave
program which will report the highest of the under-threshold results
if nothing else is found.
Example of pretty_print output:
SIGCLEAVE of sigtest from: 1 to 146
Report scores over 3.5
Maximum score 4.9 at residue 131
Sequence: FVILAAMSIQGSA-NLQTQWKSTASLALET
| (signal) | (mature peptide)
118 131
Other entries above 3.5
Maximum score 3.7 at residue 112
Sequence: CSRQLFGWLFCKV-HPGAIVFVILAAMSIQGSANLQTQWKSTASLALET
| (signal) | (mature peptide)
99 112
Methods
Methods description
Title : threshold
Usage : $value = $self->threshold
Purpose : Read/write method sigcleave score reporting threshold.
Returns : float.
Argument : new value, float
Throws : on non-number argument
Comments : defaults to 3.5
See Also : n/a |
Title : matrix
Usage : $value = $self->matrix('procaryotic')
Purpose : Read/write method sigcleave matrix.
Returns : float.
Argument : new value: 'eucaryotic' or 'procaryotic'
Throws : on non-number argument
Comments : defaults to 3.5
See Also : n/a |
Title : seq
Usage : $value = $self->seq('procaryotic')
Purpose : Read/write method sigcleave seq.
Returns : float.
Argument : new value: 'eucaryotic' or 'procaryotic'
Throws : on non-number argument
Comments : defaults to 3.5
See Also : n/a |
Title : _Analyze
Usage : N/A This is an internal method. Not meant to be called from outside
: the package
:
Purpose : calculates sigcleave score and amino acid position for the
: given protein sequence. The score reporting threshold can
: be adjusted by passing in the "threshold" parameter during
: object construction. If no threshold is passed in, the code
: defaults to reporting any scores equal to or above 3.5
:
Returns : nothing. results are added to the object
Argument : none.
Throws : nothing.
Comments : nothing.
See Also : n/a |
Title : signals
Usage : %sigcleave_results = $sig->signals;
:
Purpose : Accessor method for sigcleave results
:
Returns : Associative array. The key value represents the amino acid position
: and the value represents the score. Only scores that
: are greater than or equal to the THRESHOLD value are reported.
:
Argument : none.
Throws : none.
Comments : none.
See Also : THRESHOLD |
Title : result_count
Usage : $count = $sig->result_count;
:
Purpose : Accessor method for sigcleave results
:
Returns : Integer, number of results above the threshold
:
Argument : none.
Throws : none.
Comments : none.
See Also : THRESHOLD |
Title : pretty_print
Usage : $output = $sig->pretty_print;
: print $sig->pretty_print;
:
Purpose : Emulates the output of the EGCG Sigcleave
: utility.
:
Returns : A formatted string.
Argument : none.
Throws : none.
Comments : none.
See Also : n/a |
Methods code
sub new
{ my ($class, @args) = @_;
my $self = $class->SUPER::new(@args);
my ($seq, $threshold, $matrix) = $self->_rearrange([qw(SEQ THRESHOLD MATRIX)],@args);
defined $threshold && $self->threshold($threshold);
$matrix && $self->matrix($matrix);
$seq && $self->seq($seq);
return $self;} |
sub threshold
{ my ($self, $value) = @_;
if( defined $value) {
$self->throw("I need a number, not [$value]")
if $value !~ /^[+-]?[\d\.]+$/;
$self->{'_threshold'} = $value;
}
return $self->{'_threshold'} || 3.5 ; } |
sub matrix
{ my ($self, $value) = @_;
if( defined $value) {
$self->throw("I need 'eucaryotic' or 'procaryotic', not [$value]")
unless $value eq 'eucaryotic' or $value eq 'procaryotic';
$self->{'_matrix'} = $value;
}
return $self->{'_matrix'} || 'eucaryotic' ; } |
sub seq
{ my ($self, $value) = @_;
if( defined $value) {
if ($value->isa('Bio::PrimarySeqI')) {
$self->{'_seq'} = $value;
} else {
$self->{'_seq'} = Bio::PrimarySeq->new(-seq=>$value,
-alphabet=>'protein');
}
}
return $self->{'_seq'}; } |
sub _Analyze
{ my($self) = @_;
my %signals;
my @hitWeight = ();
my @hitsort = ();
my @hitpos = ();
my $maxSite = "";
my $seqPos = "";
my $istart = "";
my $iend = "";
my $icol = "";
my $i = "";
my $weight = "";
my $k = 0;
my $c = 0;
my $seqBegin = 0;
my $pVal = -13;
my $nVal = 2;
my $nHits = 0;
my $seqEnd = $self->seq->length;
my $pep = $self->seq->seq;
my $minWeight = $self->threshold;
my $matrix = $self->matrix;
$pep =~ tr/a-z/A-Z/;
for ($seqPos = $seqBegin; $seqPos < $seqEnd; $seqPos++) {
$istart = (0 > $seqPos + $pVal)? 0 : $seqPos + $pVal;
$iend = ($seqPos + $nVal - 1 < $seqEnd)? $seqPos + $nVal - 1 : $seqEnd;
$icol= $iend - $istart + 1;
$weight = 0.00;
for ($k=0; $k<$icol; $k++) {
$c = substr($pep, $istart + $k, 1);
if ($matrix eq 'eucaryotic') {
$weight += $WeightTable_euc{$c}[$k] if defined $WeightTable_euc{$c}[$k];
} else {
$weight += $WeightTable_pro{$c}[$k] if defined $WeightTable_pro{$c}[$k];
}
}
$signals{$seqPos+1} = sprintf ("%.1f", $weight) if $weight >= $minWeight;
}
$self->{"_signal_scores"} = { %signals }; } |
sub signals
{ my $self = shift;
my %results;
my $position;
$self->_Analyze;
foreach $position ( sort keys %{ $self->{'_signal_scores'} } ) {
$results{$position} = $self->{'_signal_scores'}{$position};
}
return %results; } |
sub result_count
{ my $self = shift;
$self->_Analyze;
return keys %{ $self->{'_signal_scores'} }; } |
sub pretty_print
{ my $self = shift;
my $pos;
my $output;
my $cnt = 1;
my %results = $self->signals;
my @hits = keys %results;
my $hitcount = $#hits; $hitcount++;
my $thresh = $self->threshold;
my $seqlen = $self->seq->length || 0;
my $name = $self->seq->id || 'NONAME';
my $pep = $self->seq->seq;
$pep =~ tr/a-z/A-Z/;
$output = "SIGCLEAVE of $name from: 1 to $seqlen\n\n";
if ($hitcount > 0) {
$output .= "Report scores over $thresh\n";
foreach $pos ((sort { $results{$b} cmp $results{$a} } keys %results)) {
my $start = $pos - 15;
$start = 1 if $start < 1;
my $sig = substr($pep,$start -1,$pos-$start );
$output .= sprintf ("Maximum score %1.1f at residue %3d\n",$results{$pos},$pos);
$output .= "\n";
$output .= " Sequence: ";
$output .= $sig;
$output .= "-" x (15- length($sig));
$output .= "-";
$output .= substr($pep,$pos-1,50);
$output .= "\n";
$output .= " " x 12;
$output .= "|\( signal\) |\( mature peptide\)\n";
$output .= sprintf(" %3d %3d\n\n",$start,$pos);
if (($hitcount > 1) && ($cnt == 1)) {
$output .= " Other entries above $thresh\n\n";
}
$cnt++;
}
}
$output; } |
General documentation
When updating and maintaining a module, it helps to know that people
are actually using it. Let us know if you find a bug, think this code
is useful or have any improvements/features to suggest.
Report bugs to the Bioperl bug tracking system to help us keep track
the bugs and their resolution. Bug reports can be submitted via email
or the web:
bioperl-bugs@bio.perl.org
http://bugzilla.bioperl.org/
Bio::Tools::Sigcleave.pm, $Id: Sigcleave.pm,v 1.18 2003/06/04 08:36:43 heikki Exp $
Copyright (c) 1999 Chris Dagdigian & others. All Rights Reserved.
This module is free software; you can redistribute it and/or modify it
under the same terms as Perl itself.
von Heijne G. (1986) "A new method for predicting signal sequences
cleavage sites." Nucleic Acids Res. 14, 4683-4690.
von Heijne G. (1987) in "Sequence Analysis in Molecular Biology:
Treasure Trove or Trivial Pursuit" (Acad. Press, (1987), 113-117).
The following documentation describes the various functions
contained in this module. Some functions are for internal
use and are not meant to be called by the user; they are
preceded by an underscore ("_").